PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g060290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 735aa    MW: 81283.8 Da    PI: 7.393
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g060290.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.26e-1861116156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k  +++++q++e+e++F+++++p+ ++r+ L ++lgL+  q+k+WFqN+R++ k
  Csa07g060290.1  61 KKKYNRHSEYQIQEMEAFFRECPHPDVKQRQVLGRQLGLKPMQIKFWFQNKRTQNK 116
                     789999***********************************************998 PP

2START163.81.2e-512504693206
                     HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     a  a++el+++a++ ep+W++ +      +n   + ++f ++        +++ea+r++++v+m+++ +ve l++ +  W++++     +a+t+e
  Csa07g060290.1 250 AIGAMEELLLMAQVVEPLWSRGVngtnLALNMIGYKRTFRTG-LgprlsgFRIEASRETAIVPMNPTGVVEMLMQAN-LWSTMFVgmvgRAMTHE 342
                     6789*******************8754233333344444333.2589999***************************.***************** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                     ++ ++      galq m+ae+q lsplvp R+++fvRy++q+g+  w++vdvS+d+  ++      ++++++pSg+li++ + g+skvtwvehv+
  Csa07g060290.1 343 KLLPDvagnfnGALQIMTAEYQELSPLVPtRESYFVRYCKQQGDNLWAVVDVSIDHLFPNIH----MKCRRRPSGCLIQEIPSGYSKVTWVEHVE 433
                     *********************************************************99975....999************************** PP

                     --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++r   ++++++++++g+a++a++wvatl+rqce+
  Csa07g060290.1 434 VDDREAnQNIFKHFISTGQAFAANRWVATLERQCER 469
                     ****999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1853119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-1955120IPR009057Homeodomain-like
PROSITE profilePS5007115.93758118IPR001356Homeobox domain
SMARTSM003891.1E-1660122IPR001356Homeobox domain
PfamPF000461.9E-1561116IPR001356Homeobox domain
CDDcd000866.87E-1661119No hitNo description
PROSITE profilePS5084837.982239472IPR002913START domain
SuperFamilySSF559612.53E-31240471No hitNo description
CDDcd088751.27E-107243468No hitNo description
SMARTSM002342.5E-41248469IPR002913START domain
PfamPF018527.9E-43250469IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-6301434IPR023393START-like domain
SuperFamilySSF559611.65E-12527718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MSESNMVPVG NNGDNDNKEN NVMNNTDGGA GVGAEEIDSA KTVSDNREEA MGSNEGPPRK  60
KKKYNRHSEY QIQEMEAFFR ECPHPDVKQR QVLGRQLGLK PMQIKFWFQN KRTQNKNHQG  120
HCENIGLWSL NDKLSSENQR FREAVFLALC PKCGGQTAIG EMSLEEHHLR IVNARLNDEI  180
NELTALAERF TSTMVINNPA MSPRPFHRPS TFEFGAGSST GRELYGNGGN LSRGITGPAD  240
ADKPMIIDLA IGAMEELLLM AQVVEPLWSR GVNGTNLALN MIGYKRTFRT GLGPRLSGFR  300
IEASRETAIV PMNPTGVVEM LMQANLWSTM FVGMVGRAMT HEKLLPDVAG NFNGALQIMT  360
AEYQELSPLV PTRESYFVRY CKQQGDNLWA VVDVSIDHLF PNIHMKCRRR PSGCLIQEIP  420
SGYSKVTWVE HVEVDDREAN QNIFKHFIST GQAFAANRWV ATLERQCERL ASNCIVTTDF  480
QSVDSADHLA LTDHGKMSIL KLAHRIAKTF FIGLTNSMGS TCSGVGGKDI RVMKMKNLIE  540
PGRPPGVVLS ASTSFWVPVP PTIVFDFLRN EDHRANWDVL CNGWILQKIS EIANGRDSRN  600
CATLLRLQNK STWQTKKMMI QETFTDPTAS FVIYAPVDTA SIEGLLNLGT DPDYVALLPS  660
GFAILPDGIG DQPGGNGGGS LLTVSLQMLV EEVPLGKLST SSVKSVEKLI RATVMRIKDL  720
FPLHIATPST RKVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417818.10.0PREDICTED: homeobox-leucine zipper protein HDG3-like
SwissprotQ9ZV650.0HDG3_ARATH; Homeobox-leucine zipper protein HDG3
TrEMBLR0HIB70.0R0HIB7_9BRAS; Uncharacterized protein
STRINGAT2G32370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32370.10.0homeodomain GLABROUS 3